PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10015099m
Common NameCARUB_v10015099mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 298aa    MW: 33653.1 Da    PI: 7.9662
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10015099mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14e-182471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G ++W+++++  g+ R++k+c++rw +yl
  Carubv10015099m 24 RGLWSPEEDEKLLRYITTHGHPSWSSVPKLAGLQRCGKSCRLRWINYL 71
                     788*******************************************97 PP

2Myb_DNA-binding53.36.2e-1777120146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++ +eE+++++d+++ lG++ W+ Ia++++ gRt++++k++w++
  Carubv10015099m  77 RGSFNEEEEQIIIDVHRILGNK-WAQIAKHLP-GRTDNEVKNFWNS 120
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-251674IPR009057Homeodomain-like
PROSITE profilePS5129417.6531971IPR017930Myb domain
SuperFamilySSF466896.68E-2922118IPR009057Homeodomain-like
SMARTSM007171.1E-122373IPR001005SANT/Myb domain
PfamPF002491.4E-152471IPR001005SANT/Myb domain
CDDcd001678.39E-112771No hitNo description
PROSITE profilePS5129426.60672126IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2575126IPR009057Homeodomain-like
SMARTSM007177.0E-1676124IPR001005SANT/Myb domain
PfamPF002492.5E-1577120IPR001005SANT/Myb domain
CDDcd001671.22E-1179119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MREKWEMKRD EMGHRCCGKH KVKRGLWSPE EDEKLLRYIT THGHPSWSSV PKLAGLQRCG  60
KSCRLRWINY LRPDLKRGSF NEEEEQIIID VHRILGNKWA QIAKHLPGRT DNEVKNFWNS  120
CIKKKLLSQG LDPSTHNLMP SHKRSSSSSN ISNNVSKPRS KTTSIMKNPS DLDQATTAFS  180
ITNINPPTSN KPNRLKSPVR TLTPSQAMIP INDTMSSLLD DENMIPHWSH VDEMAIHEAP  240
MLPGDKPVAG VDDDDLNMDI LFNTPSSSAF DPDFASIFSS AMSSIDFNPM DDLGWTF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31241267108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0395540.0AY039554.1 Arabidopsis thaliana AT3g12720/MBK21_8 mRNA, complete cds.
GenBankAY1021550.0AY102155.1 Arabidopsis thaliana AT3g12720/MBK21_8 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298974.10.0hypothetical protein CARUB_v10015099mg
TrEMBLR0G8B00.0R0G8B0_9BRAS; Uncharacterized protein
STRINGscaffold_301452.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79552539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.11e-178myb domain protein 67